PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_010097-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family WRKY
Protein Properties Length: 223aa    MW: 25874 Da    PI: 9.3906
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_010097-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY102.52.3e-32145203159
                    ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                    ldDgy+WrKYGqK+vk++++prsYYrCt+ +C+vkk+ver aedp++v++tYeg+H h+
  NNU_010097-RA 145 LDDGYKWRKYGQKVVKNTQHPRSYYRCTQDNCRVKKRVERLAEDPRMVITTYEGRHVHS 203
                    59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.8E-33130203IPR003657WRKY domain
SuperFamilySSF1182901.44E-28137204IPR003657WRKY domain
PROSITE profilePS5081129.356140205IPR003657WRKY domain
SMARTSM007749.8E-37145204IPR003657WRKY domain
PfamPF031063.3E-25146202IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1901141Biological Processregulation of lignin biosynthetic process
GO:1904369Biological Processpositive regulation of sclerenchyma cell differentiation
GO:0001046Molecular Functioncore promoter sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 223 aa     Download sequence    Send to blast
MFSTSQTMLN QGLFEDQEMP SQMGFYSSPN WSFSPFGFHQ SSRPLNNNHP TSPGENDTCH  60
LPEGLSSRAL KHKDIASFGE FESSSVQRSA NNLWPWREVN ECLGSKRYGE DPLGVAAMKM  120
KKVKARRKVR EPRFCFKTMS DVDVLDDGYK WRKYGQKVVK NTQHPRSYYR CTQDNCRVKK  180
RVERLAEDPR MVITTYEGRH VHSPSHDLDQ SSQAPPQINN FFW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-26136202874Probable WRKY transcription factor 4
2lex_A1e-26136202874Probable WRKY transcription factor 4
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB3798941e-115AB379894.1 Nelumbo nucifera DNA, microsatellite locus NS090.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010261027.11e-170PREDICTED: probable WRKY transcription factor 13
TrEMBLA0A061DJ421e-106A0A061DJ42_THECC; WRKY DNA-binding protein 13
STRINGVIT_07s0031g01840.t011e-105(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G39410.17e-53WRKY DNA-binding protein 13